PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr031373.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 352aa    MW: 39777.1 Da    PI: 4.6661
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr031373.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.63.9e-5661331128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  lppGfrFhPtdeelv +yL +k++g+++el e+i+evd+yk+ePwdLp k  + +++ ewyf+s+rd+ky++g+r+nrat++gyWkatgkd++v s +
  Pbr031373.1   6 LPPGFRFHPTDEELVAYYLDRKINGRTIEL-EIIPEVDLYKCEPWDLPdKsFLPSKDMEWYFYSPRDRKYPNGSRTNRATRAGYWKATGKDRAVNS-Q 101
                  79****************************.99**************96435566888**************************************.8 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  +++vg+kktLv+y+grap+g +t+Wvmheyrl
  Pbr031373.1 102 RRAVGMKKTLVYYRGRAPHGIRTNWVMHEYRL 133
                  999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-643157IPR003441NAC domain
PROSITE profilePS5100560.5936157IPR003441NAC domain
PfamPF023655.5E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MAPMSLPPGF RFHPTDEELV AYYLDRKING RTIELEIIPE VDLYKCEPWD LPDKSFLPSK  60
DMEWYFYSPR DRKYPNGSRT NRATRAGYWK ATGKDRAVNS QRRAVGMKKT LVYYRGRAPH  120
GIRTNWVMHE YRLVNSVCGN ASSSLKDSYA LCRVFKKTIQ MPKSNKEYTP IGINNADNDS  180
IWVSNEQLLG EDTSGINEGA SRGIETDQDE NYSNHDHPKF LSDTSSSDLT QGTPTETGIA  240
DDLQAPFASD EANSSADLYS FGVHCSSDPL QETYIPPNAS SLNTYQFPYP PLELEDFPQI  300
NLAAETNTAK PEIIDKYMSY DKFKDYMNGT FEEIFSLCSS QDNSVPLSLQ D*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-60115712165NO APICAL MERISTEM PROTEIN
1ut4_B8e-60115712165NO APICAL MERISTEM PROTEIN
1ut7_A8e-60115712165NO APICAL MERISTEM PROTEIN
1ut7_B8e-60115712165NO APICAL MERISTEM PROTEIN
3swm_A1e-59115715168NAC domain-containing protein 19
3swm_B1e-59115715168NAC domain-containing protein 19
3swm_C1e-59115715168NAC domain-containing protein 19
3swm_D1e-59115715168NAC domain-containing protein 19
3swp_A1e-59115715168NAC domain-containing protein 19
3swp_B1e-59115715168NAC domain-containing protein 19
3swp_C1e-59115715168NAC domain-containing protein 19
3swp_D1e-59115715168NAC domain-containing protein 19
4dul_A8e-60115712165NAC domain-containing protein 19
4dul_B8e-60115712165NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009340131.10.0PREDICTED: NAC transcription factor 29-like
TrEMBLM5WNI40.0M5WNI4_PRUPE; Uncharacterized protein
STRINGPOPTR_0010s18180.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF105083341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54330.11e-107NAC domain containing protein 20